PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_031190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family S1Fa-like
Protein Properties Length: 723aa    MW: 77494.1 Da    PI: 7.6406
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_031190genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA22.62.2e-07314350541
         S1FA   5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqk 41 
                  k   kGl PGlivl+ v+    v ++g  ++yvy +k
  DCAR_031190 314 KDSGKGLKPGLIVLISVADAAGVAFIGLVVVYVYWKK 350
                  4455******************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF520581.83E-4830289IPR032675Leucine-rich repeat domain, L domain-like
PfamPF082631.6E-93069IPR013210Leucine-rich repeat-containing N-terminal, plant-type
Gene3DG3DSA:3.80.10.102.8E-5732271IPR032675Leucine-rich repeat domain, L domain-like
SMARTSM0036928100124IPR003591Leucine-rich repeat, typical subtype
PfamPF138558.9E-7125185IPR001611Leucine-rich repeat
SMARTSM003694.1148171IPR003591Leucine-rich repeat, typical subtype
PRINTSPR000192.2E-5151164No hitNo description
SMARTSM003698.5197221IPR003591Leucine-rich repeat, typical subtype
PRINTSPR000192.2E-5197210No hitNo description
PROSITE profilePS5001131.778424720IPR000719Protein kinase domain
Gene3DG3DSA:3.30.200.201.8E-14428486No hitNo description
SMARTSM002201.6E-12428720IPR000719Protein kinase domain
PfamPF000692.1E-31429644IPR000719Protein kinase domain
SuperFamilySSF561123.24E-57429717IPR011009Protein kinase-like domain
CDDcd140665.33E-89430720No hitNo description
Gene3DG3DSA:1.10.510.106.1E-32487713No hitNo description
PROSITE patternPS001080547559IPR008271Serine/threonine-protein kinase, active site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006468Biological Processprotein phosphorylation
GO:0005886Cellular Componentplasma membrane
GO:0004672Molecular Functionprotein kinase activity
GO:0005515Molecular Functionprotein binding
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 723 aa     Download sequence    Send to blast
MINLNNSVLL SLSLLIIYIN VCFVSTLSLS SDGLSLLSLK SAVESGDSVF SDWNENDADP  60
CHWSGISCSN ITNSSGPRVV AIAISGKNLR GYIPSELGAL TYLRRLNLHG NSFHGSIPAQ  120
LFNASSLHSI FLYSNNLSGS LPPALCNLPR LQNLDLSNNS LSSSIPRDFR NCRQLQRLIL  180
AENKLYGEIP VGVFPELANL VQLDLSSNLL NGSIPEDIGE LKSLSGTLNM SFNEFSGKLP  240
KSMGDLPLTV SFDLRSNKLS GEIPQTGSFA NQGPTAFLNN PLLCGFPLQK SCRGDNGSDS  300
SSGVQNVSPA SDKKDSGKGL KPGLIVLISV ADAAGVAFIG LVVVYVYWKK KESNGCSCTG  360
KRKFGSSEKG HLCVFPCIGG NSGNDSDVHS EKGGVGSGSG AGGGEGDLVA IDKGFNFELD  420
ELLRASAYVL GKSGLGIVYK VVLGNGVPVA VRRLGEGGEQ RYKEFVSEIQ AIGRVKHPNV  480
VKLRAYYWAP DEKLLISDFI SNGNLISALR GRTGHQPSSL SWSVRLGIAK GTARGLAYLH  540
ECSPRKFVHG DIKPSNILLD NELQPFISDF GLNRLINITG SNPSSSGGFI GGALPYLNSV  600
QPERANNYRA PEARITGSRP TQKWDVYSFG VVLLELLTGK SPDISPAAST STEFIDLVRW  660
VRKGFEEETP LSDMVDPLLL QEVRAKKEVL AVFHIALACT EVEPESRPRM KTVSENLERI  720
GS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4oa6_A3e-4642972027297Protein BRASSINOSTEROID INSENSITIVE 1
4oa9_A3e-4642972027297Protein BRASSINOSTEROID INSENSITIVE 1
4oab_A3e-4642972027297Protein BRASSINOSTEROID INSENSITIVE 1
4oac_A3e-4642972027297Protein BRASSINOSTEROID INSENSITIVE 1
4oh4_A5e-4642972049319Protein BRASSINOSTEROID INSENSITIVE 1
4oh4_B5e-4642972049319Protein BRASSINOSTEROID INSENSITIVE 1
4q5j_A5e-4642972049319Protein BRASSINOSTEROID INSENSITIVE 1
4q5j_B5e-4642972049319Protein BRASSINOSTEROID INSENSITIVE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015074527.10.0PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At1g66830
TrEMBLA0A068UYE90.0A0A068UYE9_COFCA; Non-specific serine/threonine protein kinase
STRINGSolyc05g015150.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA779055
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12020.21e-11WRKY family protein